Lineage for d2h9fa2 (2h9f A:187-395)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) 
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.4: PA0793-like [160123] (1 protein)
Pfam PF04303; DUF453Protein Hypothetical protein PA0793 [160124] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [160125] (1 PDB entry)
Uniprot Q9I5E5 1-182! Uniprot Q9I5E5 187-395
Domain d2h9fa2: 2h9f A:187-395 [147249]
complexed with cl, co, gol, so4
Details for d2h9fa2
PDB Entry: 2h9f (more details), 1.95 Å
PDB Description: crystal structure of a prpf family methylaconitate isomerase (pa0793) from pseudomonas aeruginosa at 1.95 a resolution
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2h9fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9fa2 d.21.1.4 (A:187-395) Hypothetical protein PA0793 {Pseudomonas aeruginosa [TaxId: 287]}
dggaifptgnlvddlevpgvgtfkatminagiptvfvnaeeigyrgtelreeingdpqql
arferirvagalrmgliktpeeaatrqhtpkiafvapprdyrtasgklvaagdidllvra
lsmgklhhammgtaavaigtaaaipgtlvnlaagggersavrfghpsgtlrvgaeasqan
gewtvtkaimsrsarilmegwvrvpgdaf
SCOPe Domain Coordinates for d2h9fa2:
Click to download the PDB-style file with coordinates for d2h9fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h9fa2:
- d2h9fa2 first appeared in SCOP 1.75
- d2h9fa2 appears in SCOPe 2.07
View in 3D
