Lineage for d2h2ka_ (2h2k A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.0: automated matches [191396] (1 protein)
not a true familyProtein automated matches [190513] (27 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189519] (38 PDB entries) 
Domain d2h2ka_: 2h2k A: [204505]
automated match to d1irjb_
complexed with ca
Details for d2h2ka_
PDB Entry: 2h2k (more details), 2 Å
PDB Description: Crystal Structure Analysis of Human S100A13
PDB Compounds: (A:) Protein S100-A13SCOPe Domain Sequences for d2h2ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2ka_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slmaaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgslde
kmksldvnqdselkfneywrligelakeirkkk
SCOPe Domain Coordinates for d2h2ka_:
Click to download the PDB-style file with coordinates for d2h2ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h2ka_:
- d2h2ka_ first appeared in SCOPe 2.03
- d2h2ka_ appears in SCOPe 2.04
- d2h2ka_ is called d2h2ka1 in SCOPe 2.06
- d2h2ka_ appears in the current release, SCOPe 2.08, called d2h2ka1
View in 3D
