Lineage for d2h00a1 (2h00 A:5-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894334Family c.66.1.54: Methyltransferase 10 domain [142651] (2 proteins)
    Pfam PF05971; DUF890
  6. 2894335Protein Methyltransferase 10 domain containing protein METT10D [142652] (1 species)
  7. 2894336Species Human (Homo sapiens) [TaxId:9606] [142653] (1 PDB entry)
    Uniprot Q86W50 42-291
  8. 2894337Domain d2h00a1: 2h00 A:5-254 [135925]
    Other proteins in same PDB: d2h00b_, d2h00c_
    complexed with cl, dtu, sah

Details for d2h00a1

PDB Entry: 2h00 (more details), 2 Å

PDB Description: Human methyltransferase 10 domain containing protein
PDB Compounds: (A:) methyltransferase 10 domain containing protein

SCOPe Domain Sequences for d2h00a1:

Sequence, based on SEQRES records: (download)

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}
vslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdks
tlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvp
qktllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteimae
ggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtm
rwalawsfyd

Sequence, based on observed residues (ATOM records): (download)

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}
vslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdks
tlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvp
qktllmdalkeeseiiydfcmcnppffgiteimaeggelefvkriihdslqlkkrlrwys
cmlgkkcslaplkeelriqgvpkvtytefcqgrtmrwalawsfyd

SCOPe Domain Coordinates for d2h00a1:

Click to download the PDB-style file with coordinates for d2h00a1.
(The format of our PDB-style files is described here.)

Timeline for d2h00a1: