Lineage for d2gxqa_ (2gxq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850434Species Thermus thermophilus [TaxId:262724] [187453] (12 PDB entries)
  8. 1850435Domain d2gxqa_: 2gxq A: [204473]
    automated match to d1q0ua_
    protein/RNA complex; complexed with amp, trs

Details for d2gxqa_

PDB Entry: 2gxq (more details), 1.2 Å

PDB Description: hera n-terminal domain in complex with amp, crystal form 1
PDB Compounds: (A:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d2gxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gxqa_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpiqaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

SCOPe Domain Coordinates for d2gxqa_:

Click to download the PDB-style file with coordinates for d2gxqa_.
(The format of our PDB-style files is described here.)

Timeline for d2gxqa_: