Lineage for d2gwxb_ (2gwx B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776879Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 776880Species Human (Homo sapiens) [TaxId:9606] [48527] (11 PDB entries)
  8. 776890Domain d2gwxb_: 2gwx B: [19324]

Details for d2gwxb_

PDB Entry: 2gwx (more details), 2.3 Å

PDB Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
PDB Compounds: (B:) protein (ppar-delta)

SCOP Domain Sequences for d2gwxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwxb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdmy

SCOP Domain Coordinates for d2gwxb_:

Click to download the PDB-style file with coordinates for d2gwxb_.
(The format of our PDB-style files is described here.)

Timeline for d2gwxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gwxa_