Class b: All beta proteins [48724] (176 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species) |
Species Neisseria meningitidis [TaxId:122586] [254835] (7 PDB entries) |
Domain d2gtqa1: 2gtq A:4-188 [241978] Other proteins in same PDB: d2gtqa2, d2gtqa3, d2gtqa4 complexed with so4, zn |
PDB Entry: 2gtq (more details), 2.05 Å
SCOPe Domain Sequences for d2gtqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtqa1 b.98.1.1 (A:4-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]} tvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvkin gaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfrk itfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsylf alvag
Timeline for d2gtqa1: