Lineage for d2goxb1 (2gox B:101-165)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908590Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
  5. 908591Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
    this is a repeat family; one repeat unit is 2gom A:105-165 found in domain
  6. 908592Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)
  7. 908593Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
    Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165
  8. 908596Domain d2goxb1: 2gox B:101-165 [147151]
    Other proteins in same PDB: d2goxa_, d2goxc_

Details for d2goxb1

PDB Entry: 2gox (more details), 2.2 Å

PDB Description: crystal structure of efb-c / c3d complex
PDB Compounds: (B:) Fibrinogen-binding protein

SCOPe Domain Sequences for d2goxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goxb1 a.7.17.1 (B:101-165) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
tdatikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlk
qglvr

SCOPe Domain Coordinates for d2goxb1:

Click to download the PDB-style file with coordinates for d2goxb1.
(The format of our PDB-style files is described here.)

Timeline for d2goxb1: