Lineage for d2gova1 (2gov A:7-190)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199172Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2199173Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2199200Family d.60.1.4: SOUL heme-binding protein [143481] (2 proteins)
    Pfam PF04832
  6. 2199201Protein Heme-binding protein 1 [143482] (1 species)
    p22HBP
  7. 2199202Species Mouse (Mus musculus) [TaxId:10090] [143483] (3 PDB entries)
    Uniprot Q9R257 1-190! Uniprot Q9R257 7-190
  8. 2199203Domain d2gova1: 2gov A:7-190 [135447]

Details for d2gova1

PDB Entry: 2gov (more details)

PDB Description: solution structure of murine p22hbp
PDB Compounds: (A:) Heme-binding protein 1

SCOPe Domain Sequences for d2gova1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gova1 d.60.1.4 (A:7-190) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
nslfgsvetwpwqvlstggkedvsyeeraceggkfatvevtdkpvdealreampkimkyv
ggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesvkieere
gitvystqfggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpygrrnevw
lvka

SCOPe Domain Coordinates for d2gova1:

Click to download the PDB-style file with coordinates for d2gova1.
(The format of our PDB-style files is described here.)

Timeline for d2gova1: