Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) |
Family d.60.1.4: SOUL heme-binding protein [143481] (2 proteins) Pfam PF04832 |
Protein Heme-binding protein 1 [143482] (1 species) p22HBP |
Species Mouse (Mus musculus) [TaxId:10090] [143483] (3 PDB entries) Uniprot Q9R257 1-190! Uniprot Q9R257 7-190 |
Domain d2gova1: 2gov A:7-190 [135447] |
PDB Entry: 2gov (more details)
SCOPe Domain Sequences for d2gova1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gova1 d.60.1.4 (A:7-190) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]} nslfgsvetwpwqvlstggkedvsyeeraceggkfatvevtdkpvdealreampkimkyv ggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesvkieere gitvystqfggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpygrrnevw lvka
Timeline for d2gova1: