Lineage for d2gmrh2 (2gmr H:36-258)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790505Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1790506Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
    Uniprot P11846
  8. 1790546Domain d2gmrh2: 2gmr H:36-258 [197975]
    Other proteins in same PDB: d2gmrh1, d2gmrl1, d2gmrm_
    automated match to d1ysth1
    complexed with bcl, bph, fe2, lda, spn, u10; mutant

Details for d2gmrh2

PDB Entry: 2gmr (more details), 2.5 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn
PDB Compounds: (H:) Photosynthetic reaction center protein H chain

SCOPe Domain Sequences for d2gmrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmrh2 b.41.1.1 (H:36-258) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlae

SCOPe Domain Coordinates for d2gmrh2:

Click to download the PDB-style file with coordinates for d2gmrh2.
(The format of our PDB-style files is described here.)

Timeline for d2gmrh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gmrh1