Lineage for d2gkmb_ (2gkm B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
lack the first helix (A)Protein Protozoan/bacterial hemoglobin [46460] (6 species) 
Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
Uniprot Q10784
Domain d2gkmb_: 2gkm B: [164743]
automated match to d1s56b_
complexed with cyn, hem, na; mutant
Details for d2gkmb_
PDB Entry: 2gkm (more details), 1.73 Å
PDB Description: crystal structure of mycobacterium tuberculosis trhbn tyrb10phe mutant
PDB Compounds: (B:) Hemoglobin-like protein HbNSCOPe Domain Sequences for d2gkmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkmb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedffvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt
SCOPe Domain Coordinates for d2gkmb_:
Click to download the PDB-style file with coordinates for d2gkmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gkmb_:
- d2gkmb_ first appeared in SCOPe 2.01
- d2gkmb_ appears in SCOPe 2.04
- d2gkmb_ appears in SCOPe 2.06
- d2gkmb_ appears in the current release, SCOPe 2.08
View in 3D
