Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Alphaherpesvirus glycoprotein E [141008] (1 species) elaborated with insertions and C-terminal extensions |
Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries) Uniprot P04488 218-394! Uniprot P04488 220-390 |
Domain d2giya1: 2giy A:218-390 [135254] Other proteins in same PDB: d2giya2, d2giyb3 |
PDB Entry: 2giy (more details), 1.78 Å
SCOPe Domain Sequences for d2giya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2giya1 b.1.1.1 (A:218-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]} hvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriy esclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglaw qaasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl
Timeline for d2giya1: