Lineage for d2giya1 (2giy A:218-390)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021377Protein Alphaherpesvirus glycoprotein E [141008] (1 species)
    elaborated with insertions and C-terminal extensions
  7. 2021378Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries)
    Uniprot P04488 218-394! Uniprot P04488 220-390
  8. 2021379Domain d2giya1: 2giy A:218-390 [135254]
    Other proteins in same PDB: d2giya2, d2giyb3

Details for d2giya1

PDB Entry: 2giy (more details), 1.78 Å

PDB Description: crystal structure of the c-terminal domain of the hsv-1 ge ectodomain
PDB Compounds: (A:) Glycoprotein E

SCOPe Domain Sequences for d2giya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2giya1 b.1.1.1 (A:218-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]}
hvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriy
esclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglaw
qaasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl

SCOPe Domain Coordinates for d2giya1:

Click to download the PDB-style file with coordinates for d2giya1.
(The format of our PDB-style files is described here.)

Timeline for d2giya1:

2021379
d2giya1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2giya2