Lineage for d2gclb_ (2gcl B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.10: SSRP1-like [141436] (2 proteins)
Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this foldProtein automated matches [190657] (2 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187743] (1 PDB entry) 
Domain d2gclb_: 2gcl B: [134992]
Other proteins in same PDB: d2gcla1
automated match to d2gcla1
complexed with cl
Details for d2gclb_
PDB Entry: 2gcl (more details), 2.21 Å
PDB Description: structure of the pob3 middle domain
PDB Compounds: (B:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic regionSCOPe Domain Sequences for d2gclb_:
Sequence, based on SEQRES records: (download)
>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne
Sequence, based on observed residues (ATOM records): (download)
>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrartfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne
SCOPe Domain Coordinates for d2gclb_:
Click to download the PDB-style file with coordinates for d2gclb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gclb_:
- d2gclb_ first appeared in SCOP 1.73, called d2gclb1
- d2gclb_ appears in SCOPe 2.04
- d2gclb_ appears in SCOPe 2.06
- d2gclb_ appears in the current release, SCOPe 2.08
View in 3D
