Lineage for d2g9hd2 (2g9h D:87-216)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894516Protein Enterotoxin type I [159934] (1 species)
  7. 1894517Species Staphylococcus aureus [TaxId:1280] [159935] (1 PDB entry)
    Uniprot Q52T95 87-216
  8. 1894518Domain d2g9hd2: 2g9h D:87-216 [145189]
    Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2, d2g9hd1
    complexed with dio, epe, so4, zn

Details for d2g9hd2

PDB Entry: 2g9h (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
PDB Compounds: (D:) extracellular enterotoxin type I

SCOPe Domain Sequences for d2g9hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9hd2 d.15.6.1 (D:87-216) Enterotoxin type I {Staphylococcus aureus [TaxId: 1280]}
qylnsarkipinlwvngkhktistdkistnkklvtaqeidvklrrylqeeyniyghnstg
kgkeygykskfysgfnkgkvlfhlndeksfsydlfytgdgvpvsflkiyednkiiesekf
hldveisyvd

SCOPe Domain Coordinates for d2g9hd2:

Click to download the PDB-style file with coordinates for d2g9hd2.
(The format of our PDB-style files is described here.)

Timeline for d2g9hd2:

1894518
d2g9hd2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2g9hd1