![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Enterotoxin type I [159934] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [159935] (1 PDB entry) Uniprot Q52T95 87-216 |
![]() | Domain d2g9hd2: 2g9h D:87-216 [145189] Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2, d2g9hd1 complexed with dio, epe, so4, zn |
PDB Entry: 2g9h (more details), 2 Å
SCOPe Domain Sequences for d2g9hd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9hd2 d.15.6.1 (D:87-216) Enterotoxin type I {Staphylococcus aureus [TaxId: 1280]} qylnsarkipinlwvngkhktistdkistnkklvtaqeidvklrrylqeeyniyghnstg kgkeygykskfysgfnkgkvlfhlndeksfsydlfytgdgvpvsflkiyednkiiesekf hldveisyvd
Timeline for d2g9hd2:
![]() Domains from other chains: (mouse over for more information) d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2 |