Lineage for d2g9hd1 (2g9h D:4-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2788946Protein Enterotoxin type I, SEI [159080] (1 species)
  7. 2788947Species Staphylococcus aureus [TaxId:1280] [159081] (1 PDB entry)
    Uniprot Q52T95 4-86
  8. 2788948Domain d2g9hd1: 2g9h D:4-86 [145188]
    Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9ha3, d2g9hb1, d2g9hb2, d2g9hd2
    complexed with dio, epe, so4, zn

Details for d2g9hd1

PDB Entry: 2g9h (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
PDB Compounds: (D:) extracellular enterotoxin type I

SCOPe Domain Sequences for d2g9hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9hd1 b.40.2.2 (D:4-86) Enterotoxin type I, SEI {Staphylococcus aureus [TaxId: 1280]}
igvgnlrnfytkhdyidlkglidknlpsanqlefstgindlisesnnwdeiskfkgkkld
ifgidyngpckskymyggatlsg

SCOPe Domain Coordinates for d2g9hd1:

Click to download the PDB-style file with coordinates for d2g9hd1.
(The format of our PDB-style files is described here.)

Timeline for d2g9hd1: