Lineage for d2g7za_ (2g7z A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) 
domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are differentFamily c.119.1.0: automated matches [191443] (1 protein)
not a true familyProtein automated matches [190655] (9 species)
not a true protein
Species Streptococcus pyogenes [TaxId:160490] [187737] (1 PDB entry) 
Domain d2g7za_: 2g7z A: [164595]
automated match to d1mgpa_
complexed with cl, gol, hxa, trs, zn
Details for d2g7za_
PDB Entry: 2g7z (more details), 2.05 Å
PDB Description: Conserved DegV-like Protein of Unknown Function from Streptococcus pyogenes M1 GAS Binds Long-chain Fatty Acids
PDB Compounds: (A:) conserved hypothetical protein SPy1493SCOPe Domain Sequences for d2g7za_:
Sequence, based on SEQRES records: (download)
>d2g7za_ c.119.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 160490]}
amgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkasksl
pktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgf
tdqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgv
lssllnvkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageasla
ltlkeriaayynhsisvletgsiiqthtgegafavmvrye
Sequence, based on observed residues (ATOM records): (download)
>d2g7za_ c.119.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 160490]}
amgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkasksl
pktsqppvglfaetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgf
tdqamkfqvveaakmakagaslneilaavqaiksktelyigvstlenlvkggrigrvtgl
nvkvvmalkndelktlvkgrgnktftkwldsylaknshrpiaeiaisyageaslaltlke
riaayynhsisvletgsiiqthtgegafavmvrye
SCOPe Domain Coordinates for d2g7za_:
Click to download the PDB-style file with coordinates for d2g7za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g7za_:
- d2g7za_ first appeared in SCOPe 2.01
- d2g7za_ appears in SCOPe 2.04
- d2g7za_ is called d2g7za1 in SCOPe 2.06
- d2g7za_ appears in the current release, SCOPe 2.08, called d2g7za1
View in 3D
