Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins) parallel beta-sheet of 7 strands, order 4321567 |
Protein Acetyl-CoA hydrolase (PA5445) [142196] (1 species) duplication: consists of two topologically similar domains; overall similarity to CitF2 |
Species Pseudomonas aeruginosa [TaxId:287] [142197] (1 PDB entry) Uniprot Q9HTC2 224-497! Uniprot Q9HTC2 3-223 |
Domain d2g39a1: 2g39 A:3-223 [134553] complexed with acy, edo |
PDB Entry: 2g39 (more details), 2.1 Å
SCOPe Domain Sequences for d2g39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} rdrvrlpslldkvmsaaeaadliqdgmtvgmsgftrageakavpqalamrakerplrisl mtgaslgndldkqlteagvlarrmpfqvdstlrkainagevmfidqhlsetveqlrnhql klpdiavieaaaiteqghivpttsvgnsasfaifakqviveinlahstnleglhdiyipt yrptrtpipltrvddrigstaipippekivaivindqpdsp
Timeline for d2g39a1: