Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Hypothetical protein PF1190 [140438] (1 species) significant sequence similarity to the half-ferritin family |
Species Pyrococcus furiosus [TaxId:2261] [140439] (1 PDB entry) Uniprot Q8U1L6 9-166 |
Domain d2fzfa1: 2fzf A:10-167 [134437] |
PDB Entry: 2fzf (more details), 2.7 Å
SCOPe Domain Sequences for d2fzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Pyrococcus furiosus [TaxId: 2261]} glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee mvkeeekkrlmryladmerghyytlraeyelllnwemy
Timeline for d2fzfa1: