Lineage for d2fu5d_ (2fu5 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124875Protein Rab8a [142293] (2 species)
  7. 2124891Species Mouse (Mus musculus) [TaxId:10090] [142294] (1 PDB entry)
    Uniprot P55258 3-175
  8. 2124893Domain d2fu5d_: 2fu5 D: [134105]
    Other proteins in same PDB: d2fu5a1, d2fu5a2, d2fu5b2, d2fu5b3
    automated match to d2fu5c1
    complexed with bme, zn

Details for d2fu5d_

PDB Entry: 2fu5 (more details), 2 Å

PDB Description: structure of rab8 in complex with mss4
PDB Compounds: (D:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d2fu5d_:

Sequence, based on SEQRES records: (download)

>d2fu5d_ c.37.1.8 (D:) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdknwk

Sequence, based on observed residues (ATOM records): (download)

>d2fu5d_ c.37.1.8 (D:) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
ktydylfkllligdsafnstfistigidfkirtieldgkriklqiwdtagqerfrtitta
yyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkdvdkrqvskergek
laldygikfmetaninvenafftlardikakmdknwk

SCOPe Domain Coordinates for d2fu5d_:

Click to download the PDB-style file with coordinates for d2fu5d_.
(The format of our PDB-style files is described here.)

Timeline for d2fu5d_: