Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.18: SWIRM domain [140222] (4 proteins) Pfam PF04433; contains extra N-terminal helix |
Protein Transcription regulatory protein swi3 [140223] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140224] (1 PDB entry) Uniprot P32591 311-395 |
Domain d2fq3a1: 2fq3 A:311-395 [133936] |
PDB Entry: 2fq3 (more details), 1.4 Å
SCOPe Domain Sequences for d2fq3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} skwfnlekihsievqslpefftnripsktpevymryrnfmvnsyrlnpneyfsvttarrn vsgdaaalfrlhkfltkwglinyqv
Timeline for d2fq3a1: