Lineage for d2fo0a3 (2fo0 A:240-530)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979723Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979724Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)
  8. 2979727Domain d2fo0a3: 2fo0 A:240-530 [133864]
    Other proteins in same PDB: d2fo0a1, d2fo0a2
    automated match to d2fo0a3
    complexed with gol, myr, p16

Details for d2fo0a3

PDB Entry: 2fo0 (more details), 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOPe Domain Sequences for d2fo0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo0a3 d.144.1.7 (A:240-530) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
nkptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmev
eeflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvl
lymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagak
fpikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmer
pegcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

SCOPe Domain Coordinates for d2fo0a3:

Click to download the PDB-style file with coordinates for d2fo0a3.
(The format of our PDB-style files is described here.)

Timeline for d2fo0a3: