Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries) |
Domain d2fo0a3: 2fo0 A:240-530 [133864] Other proteins in same PDB: d2fo0a1, d2fo0a2 automated match to d2fo0a3 complexed with gol, myr, p16 |
PDB Entry: 2fo0 (more details), 2.27 Å
SCOPe Domain Sequences for d2fo0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo0a3 d.144.1.7 (A:240-530) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]} nkptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmev eeflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvl lymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagak fpikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmer pegcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg
Timeline for d2fo0a3: