Lineage for d2fnua_ (2fnu A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
formerly omega-Aminoacid:pyruvate aminotransferase-like
Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species) Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries)
Uniprot O25130 2-372
Domain d2fnua_: 2fnu A: [133831]
automated match to d2fn6a1
complexed with pmp, ud1
Details for d2fnua_
PDB Entry: 2fnu (more details), 1.5 Å
PDB Description: PseC aminotransferase with external aldimine
PDB Compounds: (A:) aminotransferaseSCOPe Domain Sequences for d2fnua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnua_ c.67.1.4 (A:) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]}
mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
iahsvlktfesfk
SCOPe Domain Coordinates for d2fnua_:
Click to download the PDB-style file with coordinates for d2fnua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fnua_:
- d2fnua_ first appeared in SCOP 1.73, called d2fnua1
- d2fnua_ appears in SCOPe 2.03
- d2fnua_ appears in SCOPe 2.05
- d2fnua_ appears in the current release, SCOPe 2.08
View in 3D
