Lineage for d2fn9a_ (2fn9 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topology
Family c.93.1.0: automated matches [191439] (1 protein)
not a true familyProtein automated matches [190646] (77 species)
not a true protein
Species Thermotoga maritima [TaxId:243274] [187722] (4 PDB entries) 
Domain d2fn9a_: 2fn9 A: [164441]
automated match to d1dbpa_
Details for d2fn9a_
PDB Entry: 2fn9 (more details), 1.4 Å
PDB Description: thermotoga maritima ribose binding protein unliganded form
PDB Compounds: (A:) ribose ABC transporter, periplasmic ribose-binding proteinSCOPe Domain Sequences for d2fn9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fn9a_ c.93.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
gkmaivistlnnpwfvvlaetakqraeqlgyeatifdsqndtakesahfdaiiaagydai
ifnptdadgsianvkrakeagipvfcvdrginarglavaqiysdnyyggvlageyfvkfl
kekypdakeipyaellgilsaqptwdrsngfhsvvdqypefkmvaqqsaefdrdtaykvt
eqilqahpeikaiwcgndamalgamkaceaagrtdiyifgfdgaedvinaikegkqivat
imqfpklmarlavewadqylrgersfpeivpvtvelvtre
SCOPe Domain Coordinates for d2fn9a_:
Click to download the PDB-style file with coordinates for d2fn9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fn9a_:
- d2fn9a_ first appeared in SCOPe 2.01
- d2fn9a_ appears in SCOPe 2.07
View in 3D
