Lineage for d2fhfa2 (2fhf A:163-287)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375146Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2375371Protein Pullulanase PulA [158883] (1 species)
    contains two E-set domains in tandem
  7. 2375372Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
    Uniprot P07206 170-294! Uniprot P07206 295-409
  8. 2375378Domain d2fhfa2: 2fhf A:163-287 [147036]
    Other proteins in same PDB: d2fhfa3, d2fhfa4, d2fhfa5
    complexed with ca, glc

Details for d2fhfa2

PDB Entry: 2fhf (more details), 1.65 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotetraose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhfa2 b.1.18.2 (A:163-287) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk
ltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag
vlddt

SCOPe Domain Coordinates for d2fhfa2:

Click to download the PDB-style file with coordinates for d2fhfa2.
(The format of our PDB-style files is described here.)

Timeline for d2fhfa2: