Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Pullulanase PulA [158883] (1 species) contains two E-set domains in tandem |
Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries) Uniprot P07206 170-294! Uniprot P07206 295-409 |
Domain d2fhfa1: 2fhf A:288-402 [147035] Other proteins in same PDB: d2fhfa3, d2fhfa4, d2fhfa5 complexed with ca |
PDB Entry: 2fhf (more details), 1.65 Å
SCOPe Domain Sequences for d2fhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk
Timeline for d2fhfa1:
View in 3D Domains from same chain: (mouse over for more information) d2fhfa2, d2fhfa3, d2fhfa4, d2fhfa5 |