Lineage for d2ffsa1 (2ffs A:1-151)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.7: PA1206-like [143839] (1 protein) Protein Hypothetical protein PA1206 [143840] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry)
Uniprot Q9I4D2 1-151
Domain d2ffsa1: 2ffs A:1-151 [133391]
Details for d2ffsa1
PDB Entry: 2ffs (more details), 2.5 Å
PDB Description: structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1
PDB Compounds: (A:) hypothetical protein PA1206SCOPe Domain Sequences for d2ffsa1:
Sequence, based on SEQRES records: (download)
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
gdelpydafvkqayiamdvetiatirdrfga
Sequence, based on observed residues (ATOM records): (download)
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlylp
glvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdelp
ydafvkqayiamdvetiatirdrfga
SCOPe Domain Coordinates for d2ffsa1:
Click to download the PDB-style file with coordinates for d2ffsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ffsa1:
- d2ffsa1 first appeared in SCOP 1.73
- d2ffsa1 appears in SCOP 1.75
- d2ffsa1 appears in SCOPe 2.02
- d2ffsa1 appears in the current release, SCOPe 2.08
View in 3D
