Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.7: PA1206-like [143839] (1 protein) automatically mapped to Pfam PF08982 |
Protein Hypothetical protein PA1206 [143840] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry) Uniprot Q9I4D2 1-151 |
Domain d2ffsa1: 2ffs A:1-151 [133391] |
PDB Entry: 2ffs (more details), 2.5 Å
SCOPe Domain Sequences for d2ffsa1:
Sequence, based on SEQRES records: (download)
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl gdelpydafvkqayiamdvetiatirdrfga
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} mqfehlvqvndrtlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlylp glvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdelp ydafvkqayiamdvetiatirdrfga
Timeline for d2ffsa1: