Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId:6717] [141385] (2 PDB entries) Uniprot Q52V24 1-237 |
Domain d2f91a1: 2f91 A:16-244 [133150] complexed with cd, cl |
PDB Entry: 2f91 (more details), 1.2 Å
SCOPe Domain Sequences for d2f91a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav
Timeline for d2f91a1: