Lineage for d2f91a1 (2f91 A:16-244)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319321Protein Trypsin(ogen) [50515] (9 species)
  7. 1319792Species Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId:6717] [141385] (2 PDB entries)
    Uniprot Q52V24 1-237
  8. 1319793Domain d2f91a1: 2f91 A:16-244 [133150]
    complexed with cd, cl

Details for d2f91a1

PDB Entry: 2f91 (more details), 1.2 Å

PDB Description: 1.2A resolution structure of a crayfish trypsin complexed with a peptide inhibitor, SGTI
PDB Compounds: (A:) hepatopancreas trypsin

SCOPe Domain Sequences for d2f91a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]}
ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav

SCOPe Domain Coordinates for d2f91a1:

Click to download the PDB-style file with coordinates for d2f91a1.
(The format of our PDB-style files is described here.)

Timeline for d2f91a1: