Lineage for d2f8yb_ (2f8y B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
multiple repeats of beta(2)-alpha(2) motifSuperfamily d.211.1: Ankyrin repeat [48403] (2 families) 
repeats organized in elongated structuresFamily d.211.1.1: Ankyrin repeat [48404] (21 proteins)
this is a repeat family; one repeat unit is 1ixv A:101-134 found in domainProtein automated matches [190101] (7 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries) 
Domain d2f8yb_: 2f8y B: [164285]
automated match to d1ot8a_
complexed with so4
applies to all domains of a family if the common domain is composed of a different number of small repeating units
Details for d2f8yb_
PDB Entry: 2f8y (more details), 1.55 Å
PDB Description: Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
PDB Compounds: (B:) Notch homolog 1, translocation-associated (Drosophila)SCOPe Domain Sequences for d2f8yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8yb_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplha
avsadaqgvfqilirnratdldarmhdgttplilaarlavegmledlinshadvnavddl
gksalhwaaavnnvdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanr
ditdhmdrlprdiaqermhhdivrlldey
SCOPe Domain Coordinates for d2f8yb_:
Click to download the PDB-style file with coordinates for d2f8yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f8yb_:
- d2f8yb_ first appeared in SCOPe 2.01
- d2f8yb_ appears in SCOPe 2.07
View in 3D
