Lineage for d2f8yb_ (2f8y B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006628Domain d2f8yb_: 2f8y B: [164285]
    automated match to d1ot8a_
    complexed with so4

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2f8yb_

PDB Entry: 2f8y (more details), 1.55 Å

PDB Description: Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
PDB Compounds: (B:) Notch homolog 1, translocation-associated (Drosophila)

SCOPe Domain Sequences for d2f8yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8yb_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplha
avsadaqgvfqilirnratdldarmhdgttplilaarlavegmledlinshadvnavddl
gksalhwaaavnnvdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanr
ditdhmdrlprdiaqermhhdivrlldey

SCOPe Domain Coordinates for d2f8yb_:

Click to download the PDB-style file with coordinates for d2f8yb_.
(The format of our PDB-style files is described here.)

Timeline for d2f8yb_: