Lineage for d2f5ah1 (2f5a H:1-132)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739734Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2739746Domain d2f5ah1: 2f5a H:1-132 [88502]
    Other proteins in same PDB: d2f5ah2, d2f5al1, d2f5al2
    part of humanized HIV-1 neutralizing Fab 2F5

Details for d2f5ah1

PDB Entry: 2f5a (more details), 2.05 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5
PDB Compounds: (H:) protein (antibody 2f5 (heavy chain))

SCOPe Domain Sequences for d2f5ah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5ah1 b.1.1.1 (H:1-132) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlaaaaaaagpvnamd
vwgqgitvtiss

SCOPe Domain Coordinates for d2f5ah1:

Click to download the PDB-style file with coordinates for d2f5ah1.
(The format of our PDB-style files is described here.)

Timeline for d2f5ah1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5ah2