Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.4: RimM N-terminal domain-like [141338] (1 protein) Pfam PF01782 |
Protein 16S rRNA processing protein RimM, N-terminal domain [141339] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [141340] (1 PDB entry) Uniprot Q9HXQ0 7-95 |
Domain d2f1la2: 2f1l A:7-95 [132781] Other proteins in same PDB: d2f1la1 complexed with gol, unl |
PDB Entry: 2f1l (more details), 2.46 Å
SCOPe Domain Sequences for d2f1la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1la2 b.43.3.4 (A:7-95) 16S rRNA processing protein RimM, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} dlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdgeirqaelvrgrlhgkvla aklkglddreeartftgyeiciprselps
Timeline for d2f1la2: