Lineage for d2f1da2 (2f1d A:96-192)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1637214Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 1637215Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 1637234Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
    Uniprot P34047 159-255! Uniprot P34047 73-158
  8. 1637236Domain d2f1da2: 2f1d A:96-192 [132729]
    Other proteins in same PDB: d2f1db1, d2f1db2, d2f1dc1, d2f1dc2, d2f1dd1, d2f1dd2, d2f1de1, d2f1de2, d2f1df1, d2f1df2, d2f1dg1, d2f1dg2, d2f1dh1, d2f1dh2, d2f1di1, d2f1di2, d2f1dj1, d2f1dj2, d2f1dk1, d2f1dk2, d2f1dl1, d2f1dl2, d2f1dm1, d2f1dm2, d2f1dn1, d2f1dn2, d2f1do1, d2f1do2, d2f1dp1, d2f1dp2
    complexed with mn, so4

Details for d2f1da2

PDB Entry: 2f1d (more details), 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1da2 d.14.1.9 (A:96-192) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagenshhiieatfkafaralrqatetdpr

SCOPe Domain Coordinates for d2f1da2:

Click to download the PDB-style file with coordinates for d2f1da2.
(The format of our PDB-style files is described here.)

Timeline for d2f1da2: