Lineage for d2f1da2 (2f1d A:96-192)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401971Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
    duplication; there are two structural repeats of this fold
  6. 1401972Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 1401991Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
    Uniprot P34047 159-255! Uniprot P34047 73-158
  8. 1401993Domain d2f1da2: 2f1d A:96-192 [132729]
    complexed with mn, so4

Details for d2f1da2

PDB Entry: 2f1d (more details), 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1da2 d.14.1.9 (A:96-192) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagenshhiieatfkafaralrqatetdpr

SCOPe Domain Coordinates for d2f1da2:

Click to download the PDB-style file with coordinates for d2f1da2.
(The format of our PDB-style files is described here.)

Timeline for d2f1da2: