Lineage for d2ex4a1 (2ex4 A:2-224)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) 
Family c.66.1.42: AD-003 protein-like [117685] (3 proteins)
Pfam PF05891; DUF858Protein Adrenal gland protein AD-003 (C9orf32) [142597] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142598] (1 PDB entry)
Uniprot Q9BV86 1-222
Domain d2ex4a1: 2ex4 A:2-224 [132516]
Other proteins in same PDB: d2ex4b_
complexed with sah
Details for d2ex4a1
PDB Entry: 2ex4 (more details), 1.75 Å
PDB Description: Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine
PDB Compounds: (A:) adrenal gland protein AD-003SCOPe Domain Sequences for d2ex4a1:
Sequence, based on SEQRES records: (download)
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflregpnktg
tscaldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqd
ftpepdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvds
svcrdldvvrriicsaglsllaeerqenlpdeiyhvysfalr
Sequence, based on observed residues (ATOM records): (download)
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflrktgtsca
ldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqdftpe
pdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvdssvcr
dldvvrriicsaglsllaeerqenlpdeiyhvysfalr
SCOPe Domain Coordinates for d2ex4a1:
Click to download the PDB-style file with coordinates for d2ex4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ex4a1:
- d2ex4a1 first appeared in SCOP 1.73
- d2ex4a1 appears in SCOPe 2.02
- d2ex4a1 appears in SCOPe 2.04
- d2ex4a1 appears in the current release, SCOPe 2.08
View in 3D
