Lineage for d2ewga_ (2ewg A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749472Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1749473Protein automated matches [196409] (30 species)
    not a true protein
  7. 1749637Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (15 PDB entries)
  8. 1749659Domain d2ewga_: 2ewg A: [230727]
    automated match to d3id0a_
    complexed with m0n, mg, pgo

Details for d2ewga_

PDB Entry: 2ewg (more details), 2.48 Å

PDB Description: t. brucei farnesyl diphosphate synthase complexed with minodronate
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2ewga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewga_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
ktykrqk

SCOPe Domain Coordinates for d2ewga_:

Click to download the PDB-style file with coordinates for d2ewga_.
(The format of our PDB-style files is described here.)

Timeline for d2ewga_: