Lineage for d2esve2 (2esv E:119-247)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029060Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 2029078Domain d2esve2: 2esv E:119-247 [145127]
    Other proteins in same PDB: d2esva1, d2esva2, d2esvb2, d2esvb3, d2esvd1, d2esve1
    complexed with iod

Details for d2esve2

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex
PDB Compounds: (E:) KK50.4 T cell receptor beta chain

SCOPe Domain Sequences for d2esve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esve2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2esve2:

Click to download the PDB-style file with coordinates for d2esve2.
(The format of our PDB-style files is described here.)

Timeline for d2esve2: