Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein Multiple C2 and transmembrane domain-containing protein 2, MCTP2 [158940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158941] (1 PDB entry) Uniprot Q6DN12 504-629 |
Domain d2ep6a1: 2ep6 A:92-217 [146970] 3rd C2 domain |
PDB Entry: 2ep6 (more details)
SCOPe Domain Sequences for d2ep6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} dvkdvgilqvkvlkaadllaadfsgksdpfcllelgndrlqthtvyknlnpewnkvftfp ikdihdvlevtvfdedgdkppdflgkvaipllsirdgqpncyvlknkdleqafkgviyle mdliyn
Timeline for d2ep6a1: