Lineage for d2e5ia_ (2e5i A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909122Species Mouse (Mus musculus) [TaxId:10090] [226227] (5 PDB entries)
  8. 1909127Domain d2e5ia_: 2e5i A: [241688]
    automated match to d1sjra_

Details for d2e5ia_

PDB Entry: 2e5i (more details)

PDB Description: solution structure of rna binding domain 2 in heterogeneous nuclear ribonucleoprotein l-like
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein L-like

SCOPe Domain Sequences for d2e5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5ia_ d.58.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkritrpgntddpsggnkvlllsiqnplypitvdvlytvcnpvgkvqrivifkr
ngiqamvefesvlcaqkakaalngadiyagcctlkieyarptrlnvirndndswdytkpy
lgrr

SCOPe Domain Coordinates for d2e5ia_:

Click to download the PDB-style file with coordinates for d2e5ia_.
(The format of our PDB-style files is described here.)

Timeline for d2e5ia_: