Lineage for d2dyja1 (2dyj A:4-94)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) 
possible distant homologue of the type I KH domain lacking the KH motif
automatically mapped to Pfam PF02033Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (2 proteins) Protein Ribosome-binding factor A, RbfA [89921] (5 species) 
Species Thermus thermophilus [TaxId:274] [160239] (2 PDB entries)
Uniprot Q5SJV1 4-94
Domain d2dyja1: 2dyj A:4-94 [146613]
Details for d2dyja1
PDB Entry: 2dyj (more details), 1.84 Å
PDB Description: Crystal structure of ribosome-binding factor A from Thermus thermophilus HB8
PDB Compounds: (A:) ribosome-binding factor aSCOPe Domain Sequences for d2dyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyja1 d.52.7.1 (A:4-94) Ribosome-binding factor A, RbfA {Thermus thermophilus [TaxId: 274]}
gkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalrals
raerrlvaalarrvrmrrlprleflpwrasp
SCOPe Domain Coordinates for d2dyja1:
Click to download the PDB-style file with coordinates for d2dyja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dyja1:
- d2dyja1 first appeared in SCOP 1.75
- d2dyja1 appears in SCOPe 2.07
View in 3D
