Lineage for d2dwwa_ (2dww A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1994805Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)
  8. 1994809Domain d2dwwa_: 2dww A: [193390]
    automated match to d2nxbb_
    complexed with cl

Details for d2dwwa_

PDB Entry: 2dww (more details), 1.8 Å

PDB Description: Crystal structure of Bromodomain-containing protein 4
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d2dwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwwa_ a.29.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ksskiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiks
klesreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd

SCOPe Domain Coordinates for d2dwwa_:

Click to download the PDB-style file with coordinates for d2dwwa_.
(The format of our PDB-style files is described here.)

Timeline for d2dwwa_: