Lineage for d2dnsa1 (2dns A:2-363)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883669Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 883670Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 883689Domain d2dnsa1: 2dns A:2-363 [131587]
    automatically matched to 2DRW A:2-363
    complexed with ba

Details for d2dnsa1

PDB Entry: 2dns (more details), 2.4 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with D-Phenylalanine
PDB Compounds: (A:) D-amino acid amidase

SCOP Domain Sequences for d2dnsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnsa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

SCOP Domain Coordinates for d2dnsa1:

Click to download the PDB-style file with coordinates for d2dnsa1.
(The format of our PDB-style files is described here.)

Timeline for d2dnsa1: