Lineage for d2dm0a_ (2dm0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919174Species Human (Homo sapiens) [TaxId:9606] [187549] (41 PDB entries)
  8. 1919238Domain d2dm0a_: 2dm0 A: [241603]
    automated match to d1csza_

Details for d2dm0a_

PDB Entry: 2dm0 (more details)

PDB Description: solution structure of the sh2 domain of human tyrosine-protein kinase txk
PDB Compounds: (A:) Tyrosine-protein kinase TXK

SCOPe Domain Sequences for d2dm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm0a_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnkitnleiyewyhrnitrnqaehllrqeskegafivrdsrhlgsytisvfmga
rrsteaaikhyqikkndsgqwyvaerhafqsipeliwyhqhnaaglmtrlrypvglmgss
gpssg

SCOPe Domain Coordinates for d2dm0a_:

Click to download the PDB-style file with coordinates for d2dm0a_.
(The format of our PDB-style files is described here.)

Timeline for d2dm0a_: