Lineage for d2dlha_ (2dlh A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767933Protein Receptor-type tyrosine-protein phosphatase delta, PTPRD [141049] (1 species)
  7. 1767934Species Human (Homo sapiens) [TaxId:9606] [141050] (2 PDB entries)
    Uniprot P23468 504-607
  8. 1767936Domain d2dlha_: 2dlh A: [241593]
    automated match to d1wj3a_

Details for d2dlha_

PDB Entry: 2dlh (more details)

PDB Description: solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase delta

SCOPe Domain Sequences for d2dlha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlha_ b.1.2.1 (A:) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpvltqtseqapssaprdvqarmlssttilvqwkepeepngqiqgyrvyytmdp
tqhvnnwmkhnvadsqittignlvpqktysvkvlaftsigdgplssdiqvitqtgsgpss
g

SCOPe Domain Coordinates for d2dlha_:

Click to download the PDB-style file with coordinates for d2dlha_.
(The format of our PDB-style files is described here.)

Timeline for d2dlha_: