Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Receptor-type tyrosine-protein phosphatase delta, PTPRD [141049] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141050] (2 PDB entries) Uniprot P23468 504-607 |
Domain d2dlha_: 2dlh A: [241593] automated match to d1wj3a_ |
PDB Entry: 2dlh (more details)
SCOPe Domain Sequences for d2dlha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlha_ b.1.2.1 (A:) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} gssgssgpvltqtseqapssaprdvqarmlssttilvqwkepeepngqiqgyrvyytmdp tqhvnnwmkhnvadsqittignlvpqktysvkvlaftsigdgplssdiqvitqtgsgpss g
Timeline for d2dlha_: