Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein Filamin b [141025] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141026] (17 PDB entries) Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192 |
Domain d2diaa1: 2dia A:8-107 [131526] Other proteins in same PDB: d2diaa2, d2diaa3 10th repeat |
PDB Entry: 2dia (more details)
SCOPe Domain Sequences for d2diaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} pfdpskvvasgpglehgkvgeagllsvdcseagpgalgleavsdsgtkaevsiqnnkdgt yavtyvpltagmytltmkyggelvphfparvkvepavdts
Timeline for d2diaa1: