Lineage for d2depa_ (2dep A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (60 species)
not a true protein
Species Clostridium stercorarium [TaxId:1510] [187615] (1 PDB entry) 
Domain d2depa_: 2dep A: [163617]
automated match to d1hiza_
Details for d2depa_
PDB Entry: 2dep (more details), 1.8 Å
PDB Description: crystal structure of xylanase b from clostridium stercorarium f9
PDB Compounds: (A:) Thermostable celloxylanaseSCOPe Domain Sequences for d2depa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2depa_ c.1.8.0 (A:) automated matches {Clostridium stercorarium [TaxId: 1510]}
dipslaeafrdyfpigaaiepgyttgqiaelykkhvnmlvaenamkpaslqptegnfqwa
dadrivqfakengmelrfhtlvwhnqtpdwffldkegkpmveetdpqkreenrklllqrl
enyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafratreaggs
diklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesikkf
aglgldniiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsavvf
wgisdkyswlngfpvkrtnapllfdrnfmpkpafwaivdp
SCOPe Domain Coordinates for d2depa_:
Click to download the PDB-style file with coordinates for d2depa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2depa_:
- d2depa_ first appeared in SCOPe 2.01
- d2depa_ appears in SCOPe 2.03
- d2depa_ appears in SCOPe 2.05
- d2depa_ appears in the current release, SCOPe 2.08
View in 3D
