Lineage for d2ddha3 (2ddh A:1-267)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246242Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins)
  6. 2246247Protein Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 [75601] (1 species)
  7. 2246248Species Norway rat (Rattus norvegicus) [TaxId:10116] [75602] (2 PDB entries)
  8. 2246249Domain d2ddha3: 2ddh A:1-267 [131396]
    Other proteins in same PDB: d2ddha1, d2ddha2
    automated match to d1is2a3
    complexed with fad, hxd

Details for d2ddha3

PDB Entry: 2ddh (more details), 2.07 Å

PDB Description: Crystal Structure of Acyl-CoA oxidase complexed with 3-OH-dodecanoate
PDB Compounds: (A:) acyl-CoA oxidase

SCOPe Domain Sequences for d2ddha3:

Sequence, based on SEQRES records: (download)

>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
kmdnyriprenmlmkyaqvkpdgtyvk

Sequence, based on observed residues (ATOM records): (download)

>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllqataeqqe
rffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpgglg
ktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngylk
mdnyriprenmlmkyaqvkpdgtyvk

SCOPe Domain Coordinates for d2ddha3:

Click to download the PDB-style file with coordinates for d2ddha3.
(The format of our PDB-style files is described here.)

Timeline for d2ddha3: