Lineage for d2d9ia1 (2d9i A:8-90)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2200123Superfamily d.68.8: SMR domain-like [160443] (1 family) (S)
    automatically mapped to Pfam PF01713
  5. 2200124Family d.68.8.1: Smr domain [160444] (2 proteins)
    Pfam PF01713
  6. 2200125Protein Nedd4-binding protein 2 [160445] (1 species)
  7. 2200126Species Human (Homo sapiens) [TaxId:9606] [160446] (1 PDB entry)
    Uniprot Q86UW6 1688-1770
  8. 2200127Domain d2d9ia1: 2d9i A:8-90 [146475]
    Other proteins in same PDB: d2d9ia2, d2d9ia3

Details for d2d9ia1

PDB Entry: 2d9i (more details)

PDB Description: solution structure of the smr domain of nedd4-binding protein 2
PDB Compounds: (A:) NEDD4-binding protein 2

SCOPe Domain Sequences for d2d9ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9ia1 d.68.8.1 (A:8-90) Nedd4-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
qnvldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavi
kylishsfrfseikpgclkvmlk

SCOPe Domain Coordinates for d2d9ia1:

Click to download the PDB-style file with coordinates for d2d9ia1.
(The format of our PDB-style files is described here.)

Timeline for d2d9ia1: