Lineage for d2d7ca_ (2d7c A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124751Protein Rab11a [102362] (2 species)
  7. 2124758Species Human (Homo sapiens) [TaxId:9606] [102363] (4 PDB entries)
  8. 2124759Domain d2d7ca_: 2d7c A: [131317]
    Other proteins in same PDB: d2d7cc1, d2d7cd_
    automated match to d1oiwa_
    complexed with gtp, mes, mg

Details for d2d7ca_

PDB Entry: 2d7c (more details), 1.75 Å

PDB Description: crystal structure of human rab11 in complex with fip3 rab-binding domain
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2d7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7ca_ c.37.1.8 (A:) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

SCOPe Domain Coordinates for d2d7ca_:

Click to download the PDB-style file with coordinates for d2d7ca_.
(The format of our PDB-style files is described here.)

Timeline for d2d7ca_: