Lineage for d2d2fa_ (2d2f A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129263Species Thermus thermophilus HB8 [TaxId:300852] [189850] (10 PDB entries)
  8. 2129269Domain d2d2fa_: 2d2f A: [203882]
    automated match to d1vpla_
    complexed with adp, gol, mg

Details for d2d2fa_

PDB Entry: 2d2f (more details), 1.9 Å

PDB Description: Crystal structure of atypical cytoplasmic ABC-ATPase SufC from Thermus thermophilus HB8
PDB Compounds: (A:) SufC protein

SCOPe Domain Sequences for d2d2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2fa_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
sqleirdlwasidgetilkgvnlvvpkgevhalmgpngagkstlgkilagdpeytverge
illdgenilelspderarkglflafqypvevpgvtianflrlalqaklgrevgvaefwtk
vkkalelldwdesylsrylnegfsggekkrneilqllvleptyavldetdsgldidalkv
vargvnamrgpnfgalvithyqrilnyiqpdkvhvmmdgrvvatggpelaleleakgyew
lkekvk

SCOPe Domain Coordinates for d2d2fa_:

Click to download the PDB-style file with coordinates for d2d2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2d2fa_: