Lineage for d2czta_ (2czt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805711Species Mouse (Mus musculus) [TaxId:10090] [225136] (5 PDB entries)
  8. 2805712Domain d2czta_: 2czt A: [203857]
    automated match to d1gm6a_

Details for d2czta_

PDB Entry: 2czt (more details), 2 Å

PDB Description: lipocalin-type prostaglandin d synthase
PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d2czta_:

Sequence, based on SEQRES records: (download)

>d2czta_ b.60.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fqqdkflgrwysaglasnsswfrekkavlymaktvvapstegglnltstflrknqcetki
mvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfrmatlysrtq
tlkdelkekfttfskaqglteedivflpqpdkciqe

Sequence, based on observed residues (ATOM records): (download)

>d2czta_ b.60.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fqqdkflgrwysaglasnsswfrekkavlymaktvvapstegglnltstflrkncetkim
vlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfrmatlysrtqt
lkdelkekfttfskaqglteedivflpqpdkciqe

SCOPe Domain Coordinates for d2czta_:

Click to download the PDB-style file with coordinates for d2czta_.
(The format of our PDB-style files is described here.)

Timeline for d2czta_: